Lineage for d3wg7b2 (3wg7 B:91-227)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380835Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2380836Protein Cytochrome c oxidase [49544] (4 species)
  7. 2380837Species Cow (Bos taurus) [TaxId:9913] [49545] (45 PDB entries)
  8. 2380876Domain d3wg7b2: 3wg7 B:91-227 [256484]
    Other proteins in same PDB: d3wg7a_, d3wg7b1, d3wg7c_, d3wg7d_, d3wg7e_, d3wg7f_, d3wg7g_, d3wg7h_, d3wg7i_, d3wg7j_, d3wg7k_, d3wg7l_, d3wg7m_, d3wg7n_, d3wg7o1, d3wg7p_, d3wg7q_, d3wg7r_, d3wg7s_, d3wg7t_, d3wg7u_, d3wg7v_, d3wg7w_, d3wg7x_, d3wg7y_, d3wg7z_
    automated match to d1v54b1
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d3wg7b2

PDB Entry: 3wg7 (more details), 1.9 Å

PDB Description: a 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3wg7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wg7b2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d3wg7b2:

Click to download the PDB-style file with coordinates for d3wg7b2.
(The format of our PDB-style files is described here.)

Timeline for d3wg7b2: