SCOP 1.57: Domain d1b2ra1: 1b2r A:9-141

Lineage for d1b2ra1 (1b2r A:9-141)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (8 PDB entries)

8. Domain d1b2ra1: 1b2r A:9-141 [25648]
   Other proteins in same PDB: d1b2ra2

Details for d1b2ra1

PDB Entry: 1b2r, 1.8 Å

PDB Description: ferredoxin-nadp+ reductase (mutation: e 301 a)

SCOP Domain Sequences for d1b2ra1:

Sequence; same for both SEQRES and ATOM records:

>d1b2ra1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

Timeline for d1b2ra1:

• d1b2ra1 first appeared (with stable ids) in SCOP 1.55
  
• d1b2ra1 appears in SCOP 1.59
  
• d1b2ra1 appears in the current release, SCOPe 2.07