Lineage for d3wctd_ (3wct D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689451Species Lamellibrachia satsuma [TaxId:104711] [256471] (4 PDB entries)
  8. 2689455Domain d3wctd_: 3wct D: [256475]
    automated match to d2zs0c_
    complexed with ca, hem, oxy

Details for d3wctd_

PDB Entry: 3wct (more details), 2.4 Å

PDB Description: the structure of a deoxygenated 400 kda hemoglobin provides a more accurate description of the cooperative mechanism of giant hemoglobins: oxygenated form
PDB Compounds: (D:) B1 globin chain of giant V2 hemoglobin

SCOPe Domain Sequences for d3wctd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wctd_ a.1.1.0 (D:) automated matches {Lamellibrachia satsuma [TaxId: 104711]}
fcseadativikqwnqiynagigaksrwtmgneifsslfklkpesevlfnnvnvanmssg
afhahtvrvlsgldmginylndagtltsltahlaaqhvartglkavyfdamgkvlmtvlp
slidnfnpdawrncllplknaiakglp

SCOPe Domain Coordinates for d3wctd_:

Click to download the PDB-style file with coordinates for d3wctd_.
(The format of our PDB-style files is described here.)

Timeline for d3wctd_: