SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3wcha_ (3wch A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010672Family a.128.1.2: Squalene synthase [48580] (2 protein domains)
    automatically mapped to Pfam PF00494
  6. 2010678Protein automated matches [191305] (1 species)
    not a true protein
  7. 2010679Species Human (Homo sapiens) [TaxId:9606] [190011] (24 PDB entries)
  8. 2010741Domain d3wcha_: 3wch A: [256470]
    automated match to d3vjbc_
    complexed with 8ph

Details for d3wcha_

PDB Entry: 3wch (more details), 2.5 Å

PDB Description: The complex structure of HsSQS wtih ligand BPH1237
PDB Compounds: (A:) Squalene synthase

SCOPe Domain Sequences for d3wcha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wcha_ a.128.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvp
llhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigma
efldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktn
iirdyledqqggrefwpqevwsryvkklgdfalpenidlavqclnelitnalhhipdvit
ylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavlirlgqavtlmmdatnmpavk
aiiyqymeeiyhripdsnpsssktrqiistirtq

SCOPe Domain Coordinates for d3wcha_:

Click to download the PDB-style file with coordinates for d3wcha_.
(The format of our PDB-style files is described here.)

Timeline for d3wcha_: