Lineage for d1que_1 (1que 1-141)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies) 
Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) 
Family b.43.1.1: Reductases [50414] (4 proteins) Protein Ferredoxin reductase (flavodoxin reductase) [50415] (7 species) 
Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (5 PDB entries) 
Domain d1que_1: 1que 1-141 [25647]
Other proteins in same PDB: d1que_2
Details for d1que_1
PDB Entry: 1que (more details), 1.8 Å
PDB Description: x-ray structure of the ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 1.8 angstroms
SCOP Domain Sequences for d1que_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1que_1 b.43.1.1 (1-141) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
lthiepgsevkitgpvgkeml
SCOP Domain Coordinates for d1que_1:
Click to download the PDB-style file with coordinates for d1que_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1que_1:
- d1que_1 appears in SCOP 1.57
- d1que_1 appears in the current release, SCOPe 2.08, called d1quea1
View in 3D
