Lineage for d1gaqc1 (1gaq C:19-156)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669704Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 669726Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 669746Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 669787Species Maize (Zea mays), leaf isoform [TaxId:4577] [50419] (2 PDB entries)
  8. 669791Domain d1gaqc1: 1gaq C:19-156 [25646]
    Other proteins in same PDB: d1gaqa2, d1gaqb_, d1gaqc2
    complexed with fad, fes

Details for d1gaqc1

PDB Entry: 1gaq (more details), 2.59 Å

PDB Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
PDB Compounds: (C:) ferredoxin-nadp+ reductase

SCOP Domain Sequences for d1gaqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaqc1 b.43.4.2 (C:19-156) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), leaf isoform [TaxId: 4577]}
eskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
lqpgdnvqitgpvgkeml

SCOP Domain Coordinates for d1gaqc1:

Click to download the PDB-style file with coordinates for d1gaqc1.
(The format of our PDB-style files is described here.)

Timeline for d1gaqc1: