Lineage for d3wa0a2 (3wa0 A:104-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697545Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 2697546Protein automated matches [254423] (5 species)
    not a true protein
  7. 2697620Species Mouse (Mus musculus) [TaxId:10090] [255101] (5 PDB entries)
  8. 2697622Domain d3wa0a2: 3wa0 A:104-214 [256458]
    Other proteins in same PDB: d3wa0a1, d3wa0a3, d3wa0b1, d3wa0b3, d3wa0c1, d3wa0c3, d3wa0d1, d3wa0d3, d3wa0e1, d3wa0e3, d3wa0f1, d3wa0f3
    automated match to d1h4ra1

Details for d3wa0a2

PDB Entry: 3wa0 (more details), 2.31 Å

PDB Description: crystal structure of merlin complexed with dcaf1/vprbp
PDB Compounds: (A:) merlin

SCOPe Domain Sequences for d3wa0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wa0a2 a.11.2.0 (A:104-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
naeeelvqeitqhlfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

SCOPe Domain Coordinates for d3wa0a2:

Click to download the PDB-style file with coordinates for d3wa0a2.
(The format of our PDB-style files is described here.)

Timeline for d3wa0a2: