SCOPe 2.08: Domain d3tm9a_: 3tm9 A:

Lineage for d3tm9a_ (3tm9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Bacterial dimeric hemoglobin [46526] (1 species)

7. Species Vitreoscilla stercoraria [TaxId:61] [46527] (7 PDB entries)

8. Domain d3tm9a_: 3tm9 A: [256455]
   automated match to d4vhba_
   complexed with edo, hem; mutant

Details for d3tm9a_

PDB Entry: 3tm9, 1.72 Å

PDB Description: y29a mutant of vitreoscilla stercoraria hemoglobin

PDB Compounds: (A:) Bacterial hemoglobin

SCOPe Domain Sequences for d3tm9a_:

Sequence; same for both SEQRES and ATOM records:

>d3tm9a_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
mldqqtiniikatvpvlkehgvtitttfaknlfakhpevrplfdmgrqesleqpkalamt
vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
awgkaygviadvfiqveadlyaqave

Timeline for d3tm9a_:

• d3tm9a_ first appeared in SCOPe 2.04
  
• d3tm9a_ appears in SCOPe 2.07