SCOPe 2.06: Domain d2mp4a1: 2mp4 A:1-156

Lineage for d2mp4a1 (2mp4 A:1-156)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.0: automated matches [191561] (1 protein)
   not a true family

6. Protein automated matches [190971] (12 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255468] (3 PDB entries)

8. Domain d2mp4a1: 2mp4 A:1-156 [256451]
   Other proteins in same PDB: d2mp4a2
   automated match to d2lxxa_

Details for d2mp4a1

PDB Entry: 2mp4

PDB Description: Solution Structure of ADF like UNC-60A Protein of Caenorhabditis elegans

PDB Compounds: (A:) Actin-depolymerizing factor 1, isoforms a/b

SCOPe Domain Sequences for d2mp4a1:

Sequence; same for both SEQRES and ATOM records:

>d2mp4a1 d.109.1.0 (A:1-156) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mssgvmvdpdvqtsfqklsegrkeyryiifkidenkviveaavtqdqlgitgddyddssk
aafdkfvedvksrtdnltdcryavfdfkftcsrvgagtskmdkiiflqicpdgasikkkm
vyassaaaiktslgtgkilqfqvsdesemshkelln

Timeline for d2mp4a1:

• d2mp4a1 first appeared in SCOPe 2.04, called d2mp4a_
  
• d2mp4a1 was called d2mp4a_ in SCOPe 2.05
  
• d2mp4a1 appears in SCOPe 2.07
  
• d2mp4a1 appears in the current release, SCOPe 2.08