Lineage for d2mp4a1 (2mp4 A:1-156)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969935Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2969936Protein automated matches [190971] (14 species)
    not a true protein
  7. 2970003Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255468] (3 PDB entries)
  8. 2970005Domain d2mp4a1: 2mp4 A:1-156 [256451]
    Other proteins in same PDB: d2mp4a2
    automated match to d2lxxa_

Details for d2mp4a1

PDB Entry: 2mp4 (more details)

PDB Description: Solution Structure of ADF like UNC-60A Protein of Caenorhabditis elegans
PDB Compounds: (A:) Actin-depolymerizing factor 1, isoforms a/b

SCOPe Domain Sequences for d2mp4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mp4a1 d.109.1.0 (A:1-156) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mssgvmvdpdvqtsfqklsegrkeyryiifkidenkviveaavtqdqlgitgddyddssk
aafdkfvedvksrtdnltdcryavfdfkftcsrvgagtskmdkiiflqicpdgasikkkm
vyassaaaiktslgtgkilqfqvsdesemshkelln

SCOPe Domain Coordinates for d2mp4a1:

Click to download the PDB-style file with coordinates for d2mp4a1.
(The format of our PDB-style files is described here.)

Timeline for d2mp4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mp4a2