| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
| Protein automated matches [190971] (14 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255468] (3 PDB entries) |
| Domain d2mp4a1: 2mp4 A:1-156 [256451] Other proteins in same PDB: d2mp4a2 automated match to d2lxxa_ |
PDB Entry: 2mp4 (more details)
SCOPe Domain Sequences for d2mp4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mp4a1 d.109.1.0 (A:1-156) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mssgvmvdpdvqtsfqklsegrkeyryiifkidenkviveaavtqdqlgitgddyddssk
aafdkfvedvksrtdnltdcryavfdfkftcsrvgagtskmdkiiflqicpdgasikkkm
vyassaaaiktslgtgkilqfqvsdesemshkelln
Timeline for d2mp4a1: