SCOPe 2.04: Domain d2moua_: 2mou A:

Lineage for d2moua_ (2mou A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255576] (2 PDB entries)

8. Domain d2moua_: 2mou A: [256450]
   automated match to d2r55a_

Details for d2moua_

PDB Entry: 2mou

PDB Description: Solution structure of StAR-related lipid transfer domain protein 6 (STARD6)

PDB Compounds: (A:) StAR-related lipid transfer protein 6

SCOPe Domain Sequences for d2moua_:

Sequence; same for both SEQRES and ATOM records:

>d2moua_ d.129.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdfkaiaqqtaqevlgynrdtsgwkvvktskkitvsskasrkfhgnlyrvegiipespak
lsdflyqtgdritwdkslqvynmvhridsdtfichtitqsfavgsisprdfidlvyikry
egnmniissksvdfpeyppssnyirgynhpcgfvcspmeenpaysklvmfvqtemrgkls
psiiektmpsnlvnfilnakdgikahrtpsrrgfhhnshs

Timeline for d2moua_:

• d2moua_ is new in SCOPe 2.04-stable
  
• d2moua_ appears in SCOPe 2.05
  
• d2moua_ appears in the current release, SCOPe 2.08