Lineage for d2mmxa1 (2mmx A:1-98)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355823Domain d2mmxa1: 2mmx A:1-98 [256447]
    Other proteins in same PDB: d2mmxa2
    automated match to d2w0ka_

Details for d2mmxa1

PDB Entry: 2mmx (more details)

PDB Description: NMR study of 6aJL2
PDB Compounds: (A:) v1-22 protein

SCOPe Domain Sequences for d2mmxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mmxa1 b.1.1.1 (A:1-98) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssn

SCOPe Domain Coordinates for d2mmxa1:

Click to download the PDB-style file with coordinates for d2mmxa1.
(The format of our PDB-style files is described here.)

Timeline for d2mmxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mmxa2