SCOPe 2.07: Domain d2mmxa1: 2mmx A:1-98

Lineage for d2mmxa1 (2mmx A:1-98)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d2mmxa1: 2mmx A:1-98 [256447]
   Other proteins in same PDB: d2mmxa2
   automated match to d2w0ka_

Details for d2mmxa1

PDB Entry: 2mmx

PDB Description: NMR study of 6aJL2

PDB Compounds: (A:) v1-22 protein

SCOPe Domain Sequences for d2mmxa1:

Sequence; same for both SEQRES and ATOM records:

>d2mmxa1 b.1.1.1 (A:1-98) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssn

Timeline for d2mmxa1:

• d2mmxa1 first appeared in SCOPe 2.04, called d2mmxa_
  
• d2mmxa1 appears in SCOPe 2.06
  
• d2mmxa1 appears in the current release, SCOPe 2.08