Lineage for d2mlxa3 (2mlx A:248-432)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2350771Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 2350772Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families) (S)
    there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)
  5. 2350791Family a.223.1.0: automated matches [256442] (1 protein)
    not a true family
  6. 2350792Protein automated matches [256443] (3 species)
    not a true protein
  7. 2350793Species Escherichia coli [TaxId:1403831] [256444] (3 PDB entries)
  8. 2350794Domain d2mlxa3: 2mlx A:248-432 [256445]
    Other proteins in same PDB: d2mlxa1, d2mlxa2
    automated match to d1w26a1

Details for d2mlxa3

PDB Entry: 2mlx (more details)

PDB Description: NMR structure of E. coli Trigger Factor in complex with unfolded PhoA220-310
PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d2mlxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mlxa3 a.223.1.0 (A:248-432) automated matches {Escherichia coli [TaxId: 1403831]}
ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali
dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv
kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel
mnqqa

SCOPe Domain Coordinates for d2mlxa3:

Click to download the PDB-style file with coordinates for d2mlxa3.
(The format of our PDB-style files is described here.)

Timeline for d2mlxa3: