SCOPe 2.06: Domain d2mlxa3: 2mlx A:248-432

Lineage for d2mlxa3 (2mlx A:248-432)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families)
   there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)

5. Family a.223.1.0: automated matches [256442] (1 protein)
   not a true family

6. Protein automated matches [256443] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:1403831] [256444] (3 PDB entries)

8. Domain d2mlxa3: 2mlx A:248-432 [256445]
   Other proteins in same PDB: d2mlxa1, d2mlxa2
   automated match to d1w26a1

Details for d2mlxa3

PDB Entry: 2mlx

PDB Description: NMR structure of E. coli Trigger Factor in complex with unfolded PhoA220-310

PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d2mlxa3:

Sequence; same for both SEQRES and ATOM records:

>d2mlxa3 a.223.1.0 (A:248-432) automated matches {Escherichia coli [TaxId: 1403831]}
ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali
dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv
kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel
mnqqa

Timeline for d2mlxa3:

• d2mlxa3 first appeared in SCOPe 2.04
  
• d2mlxa3 appears in SCOPe 2.05
  
• d2mlxa3 appears in SCOPe 2.07
  
• d2mlxa3 appears in the current release, SCOPe 2.08