![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily) multihelical; irregular array of long and short helices |
![]() | Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families) ![]() there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family) |
![]() | Family a.223.1.0: automated matches [256442] (1 protein) not a true family |
![]() | Protein automated matches [256443] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:1403831] [256444] (3 PDB entries) |
![]() | Domain d2mlxa3: 2mlx A:248-432 [256445] Other proteins in same PDB: d2mlxa1, d2mlxa2 automated match to d1w26a1 |
PDB Entry: 2mlx (more details)
SCOPe Domain Sequences for d2mlxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mlxa3 a.223.1.0 (A:248-432) automated matches {Escherichia coli [TaxId: 1403831]} ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel mnqqa
Timeline for d2mlxa3: