Lineage for d2mlxa2 (2mlx A:132-247)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509610Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2509611Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2509932Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2509933Protein automated matches [191162] (27 species)
    not a true protein
  7. 2509971Species Escherichia coli [TaxId:1403831] [256440] (3 PDB entries)
  8. 2509972Domain d2mlxa2: 2mlx A:132-247 [256441]
    Other proteins in same PDB: d2mlxa1, d2mlxa3
    automated match to d1w26a3

Details for d2mlxa2

PDB Entry: 2mlx (more details)

PDB Description: NMR structure of E. coli Trigger Factor in complex with unfolded PhoA220-310
PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d2mlxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mlxa2 d.26.1.0 (A:132-247) automated matches {Escherichia coli [TaxId: 1403831]}
vtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgq
grmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpe

SCOPe Domain Coordinates for d2mlxa2:

Click to download the PDB-style file with coordinates for d2mlxa2.
(The format of our PDB-style files is described here.)

Timeline for d2mlxa2: