SCOPe 2.04: Domain d2mkwa_: 2mkw A:

Lineage for d2mkwa_ (2mkw A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)

8. Domain d2mkwa_: 2mkw A: [256435]
   automated match to d2w0ka_

Details for d2mkwa_

PDB Entry: 2mkw

PDB Description: Solution Structure of 6aJl2 and 6aJL2-R24G Amyloidogenics Light Chain Proteins

PDB Compounds: (A:) v1-22 protein

SCOPe Domain Sequences for d2mkwa_:

Sequence; same for both SEQRES and ATOM records:

>d2mkwa_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl

Timeline for d2mkwa_:

• d2mkwa_ is new in SCOPe 2.04-stable
  
• d2mkwa_ appears in SCOPe 2.05
  
• d2mkwa_ appears in the current release, SCOPe 2.08, called d2mkwa1