Lineage for d2mjha_ (2mjh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947178Protein automated matches [195910] (2 species)
    not a true protein
  7. 2947192Species Nematode (Caenorhabditis elegans) [TaxId:6239] [256433] (1 PDB entry)
  8. 2947193Domain d2mjha_: 2mjh A: [256434]
    automated match to d2bl5a1
    protein/RNA complex

Details for d2mjha_

PDB Entry: 2mjh (more details)

PDB Description: solution structure of the gld-1 rna-binding domain in complex with rna
PDB Compounds: (A:) Female germline-specific tumor suppressor gld-1

SCOPe Domain Sequences for d2mjha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mjha_ d.51.1.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
lpepagdmisitekiyvpkneypdynfvgrilgprgmtakqleqdtgckimvrgkgsmrd
kskesahrgkanwehleddlhvlvqcedtenrvhiklqaaleqvkkllipapegtdelkr
kqlmelaiingtyrpmkspnpa

SCOPe Domain Coordinates for d2mjha_:

Click to download the PDB-style file with coordinates for d2mjha_.
(The format of our PDB-style files is described here.)

Timeline for d2mjha_: