Lineage for d2mf2a_ (2mf2 A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families) 
contains insert beta-sheet subdomain and C-terminal helixFamily b.34.6.2: Kid/PemK [82075] (4 proteins)
automatically mapped to Pfam PF02452
Protein automated matches [228538] (5 species)
not a true protein
Species Staphylococcus aureus [TaxId:1280] [256429] (1 PDB entry) 
Domain d2mf2a_: 2mf2 A: [256430]
automated match to d4hkea_
Details for d2mf2a_
PDB Entry: 2mf2 (more details)
PDB Description: Structural and biophysical characterization of the mRNA interferase SaMazF from Staphylococcus aureus.
PDB Compounds: (A:) mRNA interferase MazFSCOPe Domain Sequences for d2mf2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mf2a_ b.34.6.2 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitg
rinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmi
slglnavahqkn
SCOPe Domain Coordinates for d2mf2a_:
Click to download the PDB-style file with coordinates for d2mf2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2mf2a_:
- d2mf2a_ first appeared in SCOPe 2.04
- d2mf2a_ is called d2mf2a1 in SCOPe 2.06
- d2mf2a_ appears in the current release, SCOPe 2.08, called d2mf2a1
View in 3D
