Lineage for d2mf2a1 (2mf2 A:14-132)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784312Family b.34.6.2: Kid/PemK [82075] (4 proteins)
    automatically mapped to Pfam PF02452
  6. 2784335Protein automated matches [228538] (6 species)
    not a true protein
  7. 2784357Species Staphylococcus aureus [TaxId:1280] [256429] (1 PDB entry)
  8. 2784358Domain d2mf2a1: 2mf2 A:14-132 [256430]
    Other proteins in same PDB: d2mf2a2, d2mf2b2
    automated match to d4hkea_

Details for d2mf2a1

PDB Entry: 2mf2 (more details)

PDB Description: Structural and biophysical characterization of the mRNA interferase SaMazF from Staphylococcus aureus.
PDB Compounds: (A:) mRNA interferase MazF

SCOPe Domain Sequences for d2mf2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mf2a1 b.34.6.2 (A:14-132) automated matches {Staphylococcus aureus [TaxId: 1280]}
irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthvei
ekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislglnavahqkn

SCOPe Domain Coordinates for d2mf2a1:

Click to download the PDB-style file with coordinates for d2mf2a1.
(The format of our PDB-style files is described here.)

Timeline for d2mf2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mf2a2