![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) ![]() contains insert beta-sheet subdomain and C-terminal helix |
![]() | Family b.34.6.2: Kid/PemK [82075] (4 proteins) automatically mapped to Pfam PF02452 |
![]() | Protein automated matches [228538] (6 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [256429] (1 PDB entry) |
![]() | Domain d2mf2a1: 2mf2 A:14-132 [256430] Other proteins in same PDB: d2mf2a2, d2mf2b2 automated match to d4hkea_ |
PDB Entry: 2mf2 (more details)
SCOPe Domain Sequences for d2mf2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mf2a1 b.34.6.2 (A:14-132) automated matches {Staphylococcus aureus [TaxId: 1280]} irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthvei ekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislglnavahqkn
Timeline for d2mf2a1: