Class b: All beta proteins [48724] (144 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species) |
Species Maize (Zea mays), leaf isoform [TaxId:4577] [50419] (2 PDB entries) |
Domain d1gawa1: 1gaw A:11-156 [25643] Other proteins in same PDB: d1gawa2, d1gawb2 |
PDB Entry: 1gaw (more details), 2.2 Å
SCOP Domain Sequences for d1gawa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gawa1 b.43.4.2 (A:11-156) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), leaf isoform} patakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipy regqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkg vcsnflcdlqpgdnvqitgpvgkeml
Timeline for d1gawa1: