SCOPe 2.08: Domain d1gawa1: 1gaw A:11-156

Lineage for d1gawa1 (1gaw A:11-156)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Maize (Zea mays), leaf isoform [TaxId:4577] [50419] (2 PDB entries)

8. Domain d1gawa1: 1gaw A:11-156 [25643]
   Other proteins in same PDB: d1gawa2, d1gawb2
   complexed with fad

Details for d1gawa1

PDB Entry: 1gaw, 2.2 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from maize leaf

PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOPe Domain Sequences for d1gawa1:

Sequence; same for both SEQRES and ATOM records:

>d1gawa1 b.43.4.2 (A:11-156) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), leaf isoform [TaxId: 4577]}
patakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipy
regqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkg
vcsnflcdlqpgdnvqitgpvgkeml

Timeline for d1gawa1:

• d1gawa1 first appeared (with stable ids) in SCOP 1.55
  
• d1gawa1 appears in SCOPe 2.07