Lineage for d2md9a1 (2md9 A:2-85)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319355Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2319356Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2319475Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)
  6. 2319476Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)
  7. 2319477Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries)
  8. 2319479Domain d2md9a1: 2md9 A:2-85 [256420]
    Other proteins in same PDB: d2md9a2
    automated match to d2gdwa_
    mutant

Details for d2md9a1

PDB Entry: 2md9 (more details)

PDB Description: solution structure of an active site mutant pepitdyl carrier protein
PDB Compounds: (A:) Tyrocidine synthase 3

SCOPe Domain Sequences for d2md9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2md9a1 a.28.1.2 (A:2-85) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
pvteaqyvaptnavesklaeiwervlgvsgigildnffqigghalkamavaaqvhreyqv
elplkvlfaqptikalaqyvatrs

SCOPe Domain Coordinates for d2md9a1:

Click to download the PDB-style file with coordinates for d2md9a1.
(The format of our PDB-style files is described here.)

Timeline for d2md9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2md9a2