| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein) |
| Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species) |
| Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries) |
| Domain d2md9a1: 2md9 A:2-85 [256420] Other proteins in same PDB: d2md9a2 automated match to d2gdwa_ mutant |
PDB Entry: 2md9 (more details)
SCOPe Domain Sequences for d2md9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2md9a1 a.28.1.2 (A:2-85) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
pvteaqyvaptnavesklaeiwervlgvsgigildnffqigghalkamavaaqvhreyqv
elplkvlfaqptikalaqyvatrs
Timeline for d2md9a1: