Lineage for d2md9a_ (2md9 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487378Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1487477Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)
  6. 1487478Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)
  7. 1487479Species Bacillus brevis [TaxId:1393] [47344] (6 PDB entries)
  8. 1487480Domain d2md9a_: 2md9 A: [256420]
    automated match to d2gdwa_
    mutant

Details for d2md9a_

PDB Entry: 2md9 (more details)

PDB Description: solution structure of an active site mutant pepitdyl carrier protein
PDB Compounds: (A:) Tyrocidine synthase 3

SCOPe Domain Sequences for d2md9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2md9a_ a.28.1.2 (A:) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
pvteaqyvaptnavesklaeiwervlgvsgigildnffqigghalkamavaaqvhreyqv
elplkvlfaqptikalaqyvatrshhhhhh

SCOPe Domain Coordinates for d2md9a_:

Click to download the PDB-style file with coordinates for d2md9a_.
(The format of our PDB-style files is described here.)

Timeline for d2md9a_: