SCOPe 2.08: Domain d2md9a1: 2md9 A:2-85

Lineage for d2md9a1 (2md9 A:2-85)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)

6. Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)

7. Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries)

8. Domain d2md9a1: 2md9 A:2-85 [256420]
   Other proteins in same PDB: d2md9a2
   automated match to d2gdwa_
   mutant

Details for d2md9a1

PDB Entry: 2md9

PDB Description: solution structure of an active site mutant pepitdyl carrier protein

PDB Compounds: (A:) Tyrocidine synthase 3

SCOPe Domain Sequences for d2md9a1:

Sequence; same for both SEQRES and ATOM records:

>d2md9a1 a.28.1.2 (A:2-85) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
pvteaqyvaptnavesklaeiwervlgvsgigildnffqigghalkamavaaqvhreyqv
elplkvlfaqptikalaqyvatrs

Timeline for d2md9a1:

• d2md9a1 first appeared in SCOPe 2.04, called d2md9a_
  
• d2md9a1 appears in SCOPe 2.07