SCOPe 2.04: Domain d2mc9a_: 2mc9 A:

Lineage for d2mc9a_ (2mc9 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (17 species)
   not a true protein

7. Species Catharanthus roseus [TaxId:4058] [256418] (1 PDB entry)

8. Domain d2mc9a_: 2mc9 A: [256419]
   automated match to d2hqja_

Details for d2mc9a_

PDB Entry: 2mc9

PDB Description: Cat r 1

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2mc9a_:

Sequence; same for both SEQRES and ATOM records:

>d2mc9a_ b.62.1.1 (A:) automated matches {Catharanthus roseus [TaxId: 4058]}
gsftgsmpnprvffdmsvggqpagrivmelfadttprtaenfralctgekgtgrsgkplh
ykdssfhrvipgfmcqggdftagngtggesiygakfadenfikkhtgpgilsmanagpnt
ngsqffictaktewldgkhvvfgqvvegmdvvkaiekvgsssgrtakkvvvedcgqls

Timeline for d2mc9a_:

• d2mc9a_ is new in SCOPe 2.04-stable
  
• d2mc9a_ appears in SCOPe 2.05
  
• d2mc9a_ appears in the current release, SCOPe 2.08, called d2mc9a1