Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries) |
Domain d2m94a_: 2m94 A: [256415] automated match to d1wt9b_ |
PDB Entry: 2m94 (more details)
SCOPe Domain Sequences for d2m94a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m94a_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} saklecpqdwlshrdkcfhvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikek ynsfwiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrw icqkelyhetlsnyvgygh
Timeline for d2m94a_: