Lineage for d2m94a_ (2m94 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002670Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries)
  8. 3002753Domain d2m94a_: 2m94 A: [256415]
    automated match to d1wt9b_

Details for d2m94a_

PDB Entry: 2m94 (more details)

PDB Description: NMR structure of the lymphocyte receptor NKR-P1A
PDB Compounds: (A:) Killer cell lectin-like receptor subfamily B member 1A

SCOPe Domain Sequences for d2m94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m94a_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
saklecpqdwlshrdkcfhvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikek
ynsfwiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrw
icqkelyhetlsnyvgygh

SCOPe Domain Coordinates for d2m94a_:

Click to download the PDB-style file with coordinates for d2m94a_.
(The format of our PDB-style files is described here.)

Timeline for d2m94a_: