Lineage for d2m80a_ (2m80 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602509Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [195631] (3 PDB entries)
  8. 1602512Domain d2m80a_: 2m80 A: [256411]
    automated match to d2ht9a_

Details for d2m80a_

PDB Entry: 2m80 (more details)

PDB Description: Solution structure of yeast dithiol glutaredoxin Grx8
PDB Compounds: (A:) Glutaredoxin-8

SCOPe Domain Sequences for d2m80a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m80a_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
msafvtkaeemikshpyfqlsaswcpdcvyansiwnklnvqdkvfvfdigslprneqekw
riafqkvvgsrnlptivvngkfwgtesqlhrfeakgtleeeltkigllp

SCOPe Domain Coordinates for d2m80a_:

Click to download the PDB-style file with coordinates for d2m80a_.
(The format of our PDB-style files is described here.)

Timeline for d2m80a_: