Lineage for d2m28a_ (2m28 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1490700Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1490701Protein automated matches [190513] (24 species)
    not a true protein
  7. 1490815Species Mouse (Mus musculus) [TaxId:10090] [255298] (2 PDB entries)
  8. 1490816Domain d2m28a_: 2m28 A: [256404]
    automated match to d1sw8a_
    complexed with ca

Details for d2m28a_

PDB Entry: 2m28 (more details)

PDB Description: NMR structure of Ca2+ bound CaBP4 C-domain
PDB Compounds: (A:) Calcium-binding protein 4

SCOPe Domain Sequences for d2m28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m28a_ a.39.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hmlgvrelriafrefdkdrdgritvaelrqaapallgeplegteldemlremdlngdgti
dfdefvmmlstg

SCOPe Domain Coordinates for d2m28a_:

Click to download the PDB-style file with coordinates for d2m28a_.
(The format of our PDB-style files is described here.)

Timeline for d2m28a_: