SCOPe 2.08: Domain d2m08a1: 2m08 A:3-93

Lineage for d2m08a1 (2m08 A:3-93)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Nitrosopumilus maritimus [TaxId:436308] [256402] (1 PDB entry)

8. Domain d2m08a1: 2m08 A:3-93 [256403]
   Other proteins in same PDB: d2m08a2
   automated match to d2m1ia_

Details for d2m08a1

PDB Entry: 2m08

PDB Description: the solution structure of nmpin, the parvuline of nitrosopumilus maritimus

PDB Compounds: (A:) PpiC-type peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2m08a1:

Sequence; same for both SEQRES and ATOM records:

>d2m08a1 d.26.1.0 (A:3-93) automated matches {Nitrosopumilus maritimus [TaxId: 436308]}
snkikcshilvskqsealaimeklksgekfgklakelsidsgsakkngnlgyftkgmmvk
pfedaafklqvgevsepiksefgyhiikrfg

Timeline for d2m08a1:

• d2m08a1 first appeared in SCOPe 2.04, called d2m08a_
  
• d2m08a1 appears in SCOPe 2.07