![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
![]() | Protein automated matches [191162] (29 species) not a true protein |
![]() | Species Nitrosopumilus maritimus [TaxId:436308] [256402] (1 PDB entry) |
![]() | Domain d2m08a1: 2m08 A:3-93 [256403] Other proteins in same PDB: d2m08a2 automated match to d2m1ia_ |
PDB Entry: 2m08 (more details)
SCOPe Domain Sequences for d2m08a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m08a1 d.26.1.0 (A:3-93) automated matches {Nitrosopumilus maritimus [TaxId: 436308]} snkikcshilvskqsealaimeklksgekfgklakelsidsgsakkngnlgyftkgmmvk pfedaafklqvgevsepiksefgyhiikrfg
Timeline for d2m08a1: