SCOP 1.75: Domain d1qg0b1: 1qg0 B:1013-1153

Lineage for d1qg0b1 (1qg0 B:1013-1153)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries)

8. Domain d1qg0b1: 1qg0 B:1013-1153 [25640]
   Other proteins in same PDB: d1qg0a2, d1qg0b2
   complexed with fad

Details for d1qg0b1

PDB Entry: 1qg0, 2.5 Å

PDB Description: wild-type pea fnr

PDB Compounds: (B:) protein (ferredoxin:nadp+ reductase)

SCOP Domain Sequences for d1qg0b1:

Sequence; same for both SEQRES and ATOM records:

>d1qg0b1 b.43.4.2 (B:1013-1153) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Garden pea (Pisum sativum) [TaxId: 3888]}
hskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigi
vpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcd
lkpgsevkitgpvgkemlmpk

Timeline for d1qg0b1:

• d1qg0b1 first appeared (with stable ids) in SCOP 1.55
  
• d1qg0b1 appears in SCOP 1.73
  
• d1qg0b1 appears in SCOPe 2.01
  
• d1qg0b1 appears in the current release, SCOPe 2.08