Lineage for d1qgab1 (1qga B:514-653)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111309Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 111386Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 111406Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 111418Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 111437Species Garden pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries)
  8. 111443Domain d1qgab1: 1qga B:514-653 [25638]
    Other proteins in same PDB: d1qgaa2, d1qgab2

Details for d1qgab1

PDB Entry: 1qga (more details), 2 Å

PDB Description: pea fnr y308w mutant in complex with nadp+

SCOP Domain Sequences for d1qgab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgab1 b.43.4.2 (B:514-653) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Garden pea (Pisum sativum)}
skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl
kpgsevkitgpvgkemlmpk

SCOP Domain Coordinates for d1qgab1:

Click to download the PDB-style file with coordinates for d1qgab1.
(The format of our PDB-style files is described here.)

Timeline for d1qgab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qgab2