SCOPe 2.05: Domain d1qgaa1: 1qga A:1-153

Lineage for d1qgaa1 (1qga A:1-153)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries)

8. Domain d1qgaa1: 1qga A:1-153 [25637]
   Other proteins in same PDB: d1qgaa2, d1qgab2
   complexed with fad, nap, so4; mutant

Details for d1qgaa1

PDB Entry: 1qga, 2 Å

PDB Description: pea fnr y308w mutant in complex with nadp+

PDB Compounds: (A:) protein (ferredoxin:nadp+ reductase)

SCOPe Domain Sequences for d1qgaa1:

Sequence; same for both SEQRES and ATOM records:

>d1qgaa1 b.43.4.2 (A:1-153) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Pea (Pisum sativum) [TaxId: 3888]}
qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
vvkgvcsnflcdlkpgsevkitgpvgkemlmpk

Timeline for d1qgaa1:

• d1qgaa1 first appeared (with stable ids) in SCOP 1.55
  
• d1qgaa1 appears in SCOPe 2.04
  
• d1qgaa1 appears in SCOPe 2.06
  
• d1qgaa1 appears in the current release, SCOPe 2.08