SCOP 1.75: Domain d1qfya1: 1qfy A:1-153

Lineage for d1qfya1 (1qfy A:1-153)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries)

8. Domain d1qfya1: 1qfy A:1-153 [25635]
   Other proteins in same PDB: d1qfya2, d1qfyb2

Details for d1qfya1

PDB Entry: 1qfy, 1.8 Å

PDB Description: pea fnr y308s mutant in complex with nadp+

PDB Compounds: (A:) protein (ferredoxin: nadp+ reductase)

SCOP Domain Sequences for d1qfya1:

Sequence; same for both SEQRES and ATOM records:

>d1qfya1 b.43.4.2 (A:1-153) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Garden pea (Pisum sativum) [TaxId: 3888]}
qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
vvkgvcsnflcdlkpgsevkitgpvgkemlmpk

Timeline for d1qfya1:

• d1qfya1 first appeared (with stable ids) in SCOP 1.55
  
• d1qfya1 appears in SCOP 1.73
  
• d1qfya1 appears in SCOPe 2.01
  
• d1qfya1 appears in the current release, SCOPe 2.08