Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species) |
Species Pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries) |
Domain d1qfzb1: 1qfz B:514-653 [25634] Other proteins in same PDB: d1qfza2, d1qfzb2 complexed with fad, ndp, so4; mutant |
PDB Entry: 1qfz (more details), 1.7 Å
SCOPe Domain Sequences for d1qfzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfzb1 b.43.4.2 (B:514-653) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Pea (Pisum sativum) [TaxId: 3888]} skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl kpgsevkitgpvgkemlmpk
Timeline for d1qfzb1: