Lineage for d1qfzb1 (1qfz B:514-653)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669704Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 669726Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 669746Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 669778Species Garden pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries)
  8. 669780Domain d1qfzb1: 1qfz B:514-653 [25634]
    Other proteins in same PDB: d1qfza2, d1qfzb2
    complexed with fad, ndp, so4; mutant

Details for d1qfzb1

PDB Entry: 1qfz (more details), 1.7 Å

PDB Description: pea fnr y308s mutant in complex with nadph
PDB Compounds: (B:) protein (ferredoxin:nadp+ reductase)

SCOP Domain Sequences for d1qfzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfzb1 b.43.4.2 (B:514-653) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Garden pea (Pisum sativum) [TaxId: 3888]}
skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl
kpgsevkitgpvgkemlmpk

SCOP Domain Coordinates for d1qfzb1:

Click to download the PDB-style file with coordinates for d1qfzb1.
(The format of our PDB-style files is described here.)

Timeline for d1qfzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qfzb2