![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) ![]() |
![]() | Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins) coupled with a NADP-binding domain of alpha/beta class |
![]() | Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species) |
![]() | Species Garden pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries) |
![]() | Domain d1qfza1: 1qfz A:1-153 [25633] Other proteins in same PDB: d1qfza2, d1qfzb2 |
PDB Entry: 1qfz (more details), 1.7 Å
SCOP Domain Sequences for d1qfza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfza1 b.43.4.2 (A:1-153) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Garden pea (Pisum sativum) [TaxId: 3888]} qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage vvkgvcsnflcdlkpgsevkitgpvgkemlmpk
Timeline for d1qfza1: