SCOPe 2.07: Domain d1frqa1: 1frq A:19-154

Lineage for d1frqa1 (1frq A:19-154)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)

8. Domain d1frqa1: 1frq A:19-154 [25632]
   Other proteins in same PDB: d1frqa2
   complexed with fad, po4, so4; mutant

Details for d1frqa1

PDB Entry: 1frq, 1.95 Å

PDB Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312a

PDB Compounds: (A:) protein (ferredoxin:nadp+ oxidoreductase)

SCOPe Domain Sequences for d1frqa1:

Sequence; same for both SEQRES and ATOM records:

>d1frqa1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

Timeline for d1frqa1:

• d1frqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1frqa1 appears in SCOPe 2.06
  
• d1frqa1 appears in the current release, SCOPe 2.08