SCOPe 2.06: Domain d1frna1: 1frn A:19-154

Lineage for d1frna1 (1frn A:19-154)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)

8. Domain d1frna1: 1frn A:19-154 [25631]
   Other proteins in same PDB: d1frna2
   complexed with fad, po4, so4

Details for d1frna1

PDB Entry: 1frn, 2 Å

PDB Description: the involvement of ser96 in the catalytic mechanism of ferredoxin-nadp+ reductase: structure-function relationship as studied by site-directed mutagenesis and x-ray crystallography

PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOPe Domain Sequences for d1frna1:

Sequence; same for both SEQRES and ATOM records:

>d1frna1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlyviassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

Timeline for d1frna1:

• d1frna1 first appeared (with stable ids) in SCOP 1.55, called d1frn_1
  
• d1frna1 appears in SCOPe 2.05
  
• d1frna1 appears in SCOPe 2.07
  
• d1frna1 appears in the current release, SCOPe 2.08