SCOP 1.71: Domain d1frn_1: 1frn 19-154

Lineage for d1frn_1 (1frn 19-154)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)

8. Domain d1frn_1: 1frn 19-154 [25631]
   Other proteins in same PDB: d1frn_2
   complexed with fad, po4, so4; mutant

Details for d1frn_1

PDB Entry: 1frn, 2 Å

PDB Description: the involvement of ser96 in the catalytic mechanism of ferredoxin-nadp+ reductase: structure-function relationship as studied by site-directed mutagenesis and x-ray crystallography

SCOP Domain Sequences for d1frn_1:

Sequence; same for both SEQRES and ATOM records:

>d1frn_1 b.43.4.2 (19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlyviassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

Timeline for d1frn_1:

• d1frn_1 first appeared (with stable ids) in SCOP 1.55
  
• d1frn_1 appears in SCOP 1.69
  
• d1frn_1 is called d1frna1 in SCOP 1.73
  
• d1frn_1 appears in the current release, SCOPe 2.08, called d1frna1