Lineage for d1frn_1 (1frn 19-154)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14603Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) (S)
  5. 14604Family b.43.1.1: Reductases [50414] (4 proteins)
  6. 14608Protein Ferredoxin reductase (flavodoxin reductase) [50415] (7 species)
  7. 14637Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)
  8. 14643Domain d1frn_1: 1frn 19-154 [25631]
    Other proteins in same PDB: d1frn_2

Details for d1frn_1

PDB Entry: 1frn (more details), 2 Å

PDB Description: the involvement of ser96 in the catalytic mechanism of ferredoxin-nadp+ reductase: structure-function relationship as studied by site-directed mutagenesis and x-ray crystallography

SCOP Domain Sequences for d1frn_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frn_1 b.43.1.1 (19-154) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlyviassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

SCOP Domain Coordinates for d1frn_1:

Click to download the PDB-style file with coordinates for d1frn_1.
(The format of our PDB-style files is described here.)

Timeline for d1frn_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1frn_2