Lineage for d1bx0a1 (1bx0 A:19-154)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111309Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 111386Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 111406Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 111418Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 111456Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)
  8. 111461Domain d1bx0a1: 1bx0 A:19-154 [25630]
    Other proteins in same PDB: d1bx0a2

Details for d1bx0a1

PDB Entry: 1bx0 (more details), 1.9 Å

PDB Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l

SCOP Domain Sequences for d1bx0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx0a1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

SCOP Domain Coordinates for d1bx0a1:

Click to download the PDB-style file with coordinates for d1bx0a1.
(The format of our PDB-style files is described here.)

Timeline for d1bx0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bx0a2