Lineage for d1bx0a1 (1bx0 A:19-154)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14603Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) (S)
  5. 14604Family b.43.1.1: Reductases [50414] (4 proteins)
  6. 14608Protein Ferredoxin reductase (flavodoxin reductase) [50415] (7 species)
  7. 14637Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)
  8. 14642Domain d1bx0a1: 1bx0 A:19-154 [25630]
    Other proteins in same PDB: d1bx0a2

Details for d1bx0a1

PDB Entry: 1bx0 (more details), 1.9 Å

PDB Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l

SCOP Domain Sequences for d1bx0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx0a1 b.43.1.1 (A:19-154) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

SCOP Domain Coordinates for d1bx0a1:

Click to download the PDB-style file with coordinates for d1bx0a1.
(The format of our PDB-style files is described here.)

Timeline for d1bx0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bx0a2