Lineage for d1bx1a1 (1bx1 A:19-154)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801523Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 801545Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 801565Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 801616Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)
  8. 801619Domain d1bx1a1: 1bx1 A:19-154 [25629]
    Other proteins in same PDB: d1bx1a2
    complexed with fad, po4, so4; mutant

Details for d1bx1a1

PDB Entry: 1bx1 (more details), 1.9 Å

PDB Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q
PDB Compounds: (A:) protein (ferredoxin:nadp+ oxidoreductase)

SCOP Domain Sequences for d1bx1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx1a1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

SCOP Domain Coordinates for d1bx1a1:

Click to download the PDB-style file with coordinates for d1bx1a1.
(The format of our PDB-style files is described here.)

Timeline for d1bx1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bx1a2