![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) ![]() |
![]() | Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins) coupled with a NADP-binding domain of alpha/beta class |
![]() | Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries) |
![]() | Domain d1bx1a1: 1bx1 A:19-154 [25629] Other proteins in same PDB: d1bx1a2 complexed with fad, po4, so4; mutant |
PDB Entry: 1bx1 (more details), 1.9 Å
SCOP Domain Sequences for d1bx1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bx1a1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea)} hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd lkpgaevkltgpvgke
Timeline for d1bx1a1: