Lineage for d1bx1a1 (1bx1 A:19-154)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies) 
Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) 
Family b.43.1.1: Reductases [50414] (4 proteins) Protein Ferredoxin reductase (flavodoxin reductase) [50415] (7 species) 
Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries) 
Domain d1bx1a1: 1bx1 A:19-154 [25629]
Other proteins in same PDB: d1bx1a2
Details for d1bx1a1
PDB Entry: 1bx1 (more details), 1.9 Å
PDB Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q
SCOP Domain Sequences for d1bx1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bx1a1 b.43.1.1 (A:19-154) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke
SCOP Domain Coordinates for d1bx1a1:
Click to download the PDB-style file with coordinates for d1bx1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bx1a1:
- d1bx1a1 appears in SCOP 1.57
- d1bx1a1 appears in the current release, SCOPe 2.08
View in 3D
