| Class b: All beta proteins [48724] (174 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) ![]() |
| Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins) coupled with a NADP-binding domain of alpha/beta class |
| Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries) |
| Domain d1fnba1: 1fnb A:19-154 [25628] Other proteins in same PDB: d1fnba2 complexed with fad, po4, so4 |
PDB Entry: 1fnb (more details), 1.7 Å
SCOP Domain Sequences for d1fnba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnba1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke
Timeline for d1fnba1: