SCOP 1.75: Domain d1fnba1: 1fnb A:19-154

Lineage for d1fnba1 (1fnb A:19-154)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)

8. Domain d1fnba1: 1fnb A:19-154 [25628]
   Other proteins in same PDB: d1fnba2
   complexed with fad, po4, so4

Details for d1fnba1

PDB Entry: 1fnb, 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states

PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOP Domain Sequences for d1fnba1:

Sequence; same for both SEQRES and ATOM records:

>d1fnba1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

Timeline for d1fnba1:

• d1fnba1 first appeared (with stable ids) in SCOP 1.55, called d1fnb_1
  
• d1fnba1 appears in SCOP 1.73
  
• d1fnba1 appears in SCOPe 2.01
  
• d1fnba1 appears in the current release, SCOPe 2.08