Lineage for d1fnb_1 (1fnb 19-154)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560964Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 561110Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 561132Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 561152Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 561197Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)
  8. 561199Domain d1fnb_1: 1fnb 19-154 [25628]
    Other proteins in same PDB: d1fnb_2
    complexed with fad, po4, so4

Details for d1fnb_1

PDB Entry: 1fnb (more details), 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states

SCOP Domain Sequences for d1fnb_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnb_1 b.43.4.2 (19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

SCOP Domain Coordinates for d1fnb_1:

Click to download the PDB-style file with coordinates for d1fnb_1.
(The format of our PDB-style files is described here.)

Timeline for d1fnb_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnb_2