Lineage for d1fnb_1 (1fnb 19-154)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167557Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 167645Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 167665Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins)
  6. 167681Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 167720Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)
  8. 167723Domain d1fnb_1: 1fnb 19-154 [25628]
    Other proteins in same PDB: d1fnb_2

Details for d1fnb_1

PDB Entry: 1fnb (more details), 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states

SCOP Domain Sequences for d1fnb_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnb_1 b.43.4.2 (19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

SCOP Domain Coordinates for d1fnb_1:

Click to download the PDB-style file with coordinates for d1fnb_1.
(The format of our PDB-style files is described here.)

Timeline for d1fnb_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnb_2