SCOP 1.57: Domain d1fnc_1: 1fnc 19-154

Lineage for d1fnc_1 (1fnc 19-154)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)

8. Domain d1fnc_1: 1fnc 19-154 [25627]
   Other proteins in same PDB: d1fnc_2

Details for d1fnc_1

PDB Entry: 1fnc, 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states

SCOP Domain Sequences for d1fnc_1:

Sequence; same for both SEQRES and ATOM records:

>d1fnc_1 b.43.4.2 (19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

Timeline for d1fnc_1:

• d1fnc_1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnc_1 appears in SCOP 1.59
  
• d1fnc_1 appears in the current release, SCOPe 2.08, called d1fnca1